PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022997P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 285aa    MW: 32489.2 Da    PI: 6.1782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022997P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.91.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l + ++ +G  +W++ ++  g+ R++k+c++rw +yl
   MELO3C022997P1 14 KGPWSPEEDRILTNFIQNHGHSNWRALPKQAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.17.6e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
   MELO3C022997P1  67 RGNFTKEEEDAIINLHELLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129414.292961IPR017930Myb domain
SuperFamilySSF466896.83E-3010108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-141461IPR001005SANT/Myb domain
CDDcd001675.90E-91661No hitNo description
PROSITE profilePS5129425.73762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2665116IPR009057Homeodomain-like
SMARTSM007172.7E-1566114IPR001005SANT/Myb domain
PfamPF002492.3E-1567112IPR001005SANT/Myb domain
CDDcd001671.87E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWSPE EDRILTNFIQ NHGHSNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF TKEEEDAIIN LHELLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLEKNI  120
IKKTTAPKLS ENKRKKQIKP SNSSSSIVID STNQTQVPNY SSTTMSPSSQ QSSSCEISSS  180
LTDHTYMTEN EYYSYTVEDA MPPIDESFWS DVVENSMTNS NSDSSSNSNY DSEEKREEFP  240
PVSMDMTETN SDKRLHGQCV VDDDMEFWYN VFVKAGEISE LPEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-26121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818440.0LN681844.1 Cucumis melo genomic scaffold, anchoredscaffold00057.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008460645.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLB2CZJ13e-97B2CZJ1_CAPAN; Myb-related transcription factor
STRINGSolyc09g090130.2.12e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-80myb domain protein 14